DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and KCNK13

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_071337.2 Gene:KCNK13 / 56659 HGNCID:6275 Length:408 Species:Homo sapiens


Alignment Length:388 Identity:112/388 - (28%)
Similarity:183/388 - (47%) Gaps:83/388 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKQNVRTISLIVCTFTYLLVGAAVFDALESETE---KRRWEALQDAEDMIIRKYNISQEDFKVM 62
            :.:.|.|.:.|......|||.|||||.|||...|   |:|||   :......|.:|:|:::.:..
Human    13 LNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWE---ERLANFSRGHNLSRDELRGF 74

  Fly    63 ETVVLK--SESHKAG-------QQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI 118
                |:  .|:.:||       .:|.||||||:..||::|||:|.:||:|||||:|.:.|.:||.
Human    75 ----LRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPATVGGKIFLIFYGLVGC 135

  Fly   119 PLGLVMFQSIGERVNRLSSYVIKAV-------RSSL---RCKRTVASEVD-----------LICV 162
            ...::.|....||:..:.:|::|:.       |.:|   ..|.....|||           ::.:
Human   136 SSTILFFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAGQCEVDSLAGWKPSVYYVMLI 200

  Fly   163 VTTLSSLTIAGGAAAFSKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFA-LI 226
            :.|.|.|.....:|.::..||||||||:|:||:..:||||||:|:.|  ||.........|| .:
Human   201 LCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGFGDLVSSQ--NAHYESQGLYRFANFV 263

  Fly   227 FILFGLAIVAASLNLL-VLRFVTMNTEDERRDEAQAMQALQVAVKLEGDVITSNGSILSGYEGHD 290
            |||.|:..:.:..|:: :|...::|....:.|.....|..:..::...:|:.. ||:        
Human   264 FILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCPQCQRGLLRSRRNVVMP-GSV-------- 319

  Fly   291 GQSLNGSNTSSMCSCHCICLNGNRHKKSSNLEKNNDAENQYKLRQSPTHIRHLLPEVVPMQDL 353
                                   |::.:.::|.:..||       |.|..|.|..|::.|:||
Human   320 -----------------------RNRCNISIETDGVAE-------SDTDGRRLSGEMISMKDL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 26/54 (48%)
Ion_trans_2 169..247 CDD:285168 31/79 (39%)
KCNK13NP_071337.2 Ion_trans_2 <94..150 CDD:311712 27/55 (49%)
Ion_trans_2 206..285 CDD:311712 31/80 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155115
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.