DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnk12l

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_021324748.1 Gene:kcnk12l / 564796 ZFINID:ZDB-GENE-091118-74 Length:470 Species:Danio rerio


Alignment Length:380 Identity:98/380 - (25%)
Similarity:155/380 - (40%) Gaps:103/380 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKQNVRTISLIVCTFTYLLVGAAVFDALESETE---KRRWEALQDAEDMIIRKYNISQEDFKVM 62
            :.:.|.|...|......|||.||.||.|||..:|   .:|||     |.:         .:|...
Zfish    36 LNEDNARFGLLAALILLYLLCGAVVFSALEHPSEVQAHQRWE-----EQL---------ANFTEQ 86

  Fly    63 ETVVLKS---------ESHKAG-------QQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTM 111
            .:|.|||         |:..||       .:|.|:||||:..||::|||:|.:||.||.||:|.:
Zfish    87 NSVHLKSLQVLLRQYEEAFAAGIRVDKLRARWDFSGAFYFVGTVISTIGFGMTTPVTVAGKIFLI 151

  Fly   112 CYAIVGIPLGLVMFQSIGERVNRLSSYVIKAVRSSLRCKRTVASE---------------VDLIC 161
            .|.::|....::.|....||:..:.:|:::........:..|..|               |..:.
Zfish   152 FYGLLGCAATILFFNLFLERIITMLAYIMRWCHERQLRRSGVGGEEARSEDDSLEGWKPSVYYVM 216

  Fly   162 VVTTLSSLTIAGGAAA-FSKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFAL 225
            ::..:::|.||..|:| :|..|||.||:|.|:||:..:||||||:|:.||:| ...:..|.....
Zfish   217 LILGIAALLIACSASALYSAMEGWDYFESFYFCFVAFSTIGFGDVVSSQREN-YKAQEAYRFGNC 280

  Fly   226 IFILFGLAIVAASLNLLVLRFVTMNTEDERRDEAQAMQALQVAVKLEGDVITSNGSILSGYEGHD 290
            :|||.|:..:.:..|::.:                              :|....:.:.|     
Zfish   281 LFILMGVCCIYSLFNVISI------------------------------IIKQTLNWILG----- 310

  Fly   291 GQSLNGSNTSSMC----------SCHCICL------NGNRHKKSSNLEKNNDAEN 329
              .|:.|.|...|          :|.|.|.      ..|.|....|..:.....|
Zfish   311 --KLDCSRTQCPCRGRPYRRRGRACGCCCFPRIPNQRHNHHPPPGNSRQRAQKRN 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 23/54 (43%)
Ion_trans_2 169..247 CDD:285168 31/78 (40%)
kcnk12lXP_021324748.1 Ion_trans_2 105..173 CDD:311712 26/67 (39%)
Ion_trans_2 221..303 CDD:311712 32/112 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.