DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnk18

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001177236.2 Gene:kcnk18 / 561821 ZFINID:ZDB-GENE-100405-2 Length:391 Species:Danio rerio


Alignment Length:355 Identity:80/355 - (22%)
Similarity:133/355 - (37%) Gaps:139/355 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISLIVCTFTYLLVGAAVFDALE-----SETE------KRRWEALQDAEDMIIRKYNISQEDFKVM 62
            :.||:....|.::||.||.|:|     :|:|      ::..|.:|:..|...:|:.|::..:.:.
Zfish    24 VFLILSLVLYAVLGALVFRAIEYTNPRNESEEILSIVQKVMEIVQNHTDASEQKHLINKAKYILD 88

  Fly    63 ETVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQS 127
            :....|...|    .|.|..:.::..||.||:|||...|.|..||:..:.||:|||||.|::...
Zfish    89 DYCYEKERDH----GWTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISD 149

  Fly   128 IGE-----------RVN------------RLSSY------------------------------- 138
            :|:           |:|            ||.|:                               
Zfish   150 VGDLLAVLLSKAYTRLNLFFRRWIGHQSWRLQSHEKTSALPQAQADTDGTYKFNQDVVVLETTNN 214

  Fly   139 --VIKA----------------------VRSSLRCKRTVAS-----EVD---------------- 158
              ||:.                      ||.|.|.|.|::.     |:|                
Zfish   215 QQVIQTRSSIRRGSFQLRNNKEIFDRIIVRESFRIKGTLSKSCSCPELDRVPTPKDELFNDIGQE 279

  Fly   159 --------LICVVTTLSSLTIAGGAAAFSKFEGW----SYFDSVYYCFITLTTIGFGDMVALQRD 211
                    |:.::...:.:.|..     ...:.|    .:.|:.|:.|||||||||||:|.    
Zfish   280 MEQLDVPLLVILLMVFAYMVICS-----QILKCWEKQMDHSDAFYFTFITLTTIGFGDIVP---- 335

  Fly   212 NALNRKPEYVMFALIFILFGLAIVAASLNL 241
                ..|::.|...:||:.|:||::.:..|
Zfish   336 ----EHPKFFMVTFLFIITGMAIMSMAFKL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 22/65 (34%)
Ion_trans_2 169..247 CDD:285168 24/77 (31%)
kcnk18NP_001177236.2 Ion_trans_2 <99..154 CDD:285168 22/54 (41%)
Ion_trans_2 292..367 CDD:285168 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590227
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.