DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnk2a

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_021323122.1 Gene:kcnk2a / 559728 ZFINID:ZDB-GENE-061226-2 Length:426 Species:Danio rerio


Alignment Length:288 Identity:95/288 - (32%)
Similarity:138/288 - (47%) Gaps:57/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQE--DFKVME 63
            ||.:.|..|.|:|  ..||::||.||.|||...|.             ::||.|.||  ||..|.
Zfish    55 MKWKTVLAIFLLV--VLYLIIGATVFKALEQPEEG-------------LQKYRIIQEKIDFLSMH 104

  Fly    64 TVVLKSE----------SHKAG-----------QQWKFTGAFYYATTVLTTIGYGHSTPSTVGGK 107
            |.|..||          :.:||           ..|..:.:|::|.||:||||:|:.:|.|.||:
Zfish   105 TCVNTSELEDLVKQVVLAIRAGVNPSGHPSNESSMWDLSSSFFFAGTVITTIGFGNVSPHTEGGR 169

  Fly   108 LFTMCYAIVGIPLGLVMFQSIGERVNRLSSYVIKAVRSSL------RCKRTVASEVDLI---CVV 163
            :|.:.||::||||...:...:|:::..:....|..|....      :.|..|.|.|..|   |: 
Zfish   170 IFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEKMFVKWNVSQTKIRVTSTVLFILFGCL- 233

  Fly   164 TTLSSLTIAGGAAAFSKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFI 228
                 |.:|..|..|...||||..:|:|:..||||||||||.||  ..:.:.....|......:|
Zfish   234 -----LFVALPALIFQHIEGWSALESIYFVVITLTTIGFGDFVA--GGSEIEYLDYYKPIVWFWI 291

  Fly   229 LFGLAIVAASLNLL--VLRFVTMNTEDE 254
            |.|||..||.|:::  .||.::..|::|
Zfish   292 LVGLAYFAAVLSMIGDWLRVISKKTKEE 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 22/54 (41%)
Ion_trans_2 169..247 CDD:285168 33/79 (42%)
kcnk2aXP_021323122.1 Ion_trans_2 <140..194 CDD:311712 22/53 (42%)
Ion_trans_2 232..310 CDD:311712 32/85 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2827
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.