DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcna4

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_005169005.1 Gene:kcna4 / 559036 ZFINID:ZDB-GENE-121127-2 Length:667 Species:Danio rerio


Alignment Length:120 Identity:24/120 - (20%)
Similarity:48/120 - (40%) Gaps:46/120 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQNVRTISLIVCTFTYLLVGAAVFDA----LESETEKRRWEALQDAEDMIIRKYNISQEDFKVME 63
            :.::|.::|::   .:|::|..:|.:    .|::....::.::.|                    
Zfish   484 RASMRELALLI---FFLVIGVILFSSAVYFAEADEPTSQFTSIPD-------------------- 525

  Fly    64 TVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI 118
                               ||::|...:||:|||...|.|||||:.....||.|:
Zfish   526 -------------------AFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGV 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 17/41 (41%)
Ion_trans_2 165..243 CDD:462301
kcna4XP_005169005.1 K_channel_TID 1..>21 CDD:429748
BTB_POZ 205..331 CDD:453885
Ion_trans 382..582 CDD:459842 24/120 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.