DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnk7

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001373286.1 Gene:kcnk7 / 557297 ZFINID:ZDB-GENE-110304-2 Length:362 Species:Danio rerio


Alignment Length:382 Identity:93/382 - (24%)
Similarity:162/382 - (42%) Gaps:80/382 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISLIVCTFTYLLVGAAVFDALESETEK------RRWEALQDAEDMIIRKYNISQEDFKVMETV-- 65
            |.|:|....::::||.|...||...|.      |..:|...|::..:.:.::   |..:|:.:  
Zfish    18 IFLMVAYGLFIVMGAVVLMVLEQPEENLLVQEVRELKARFLADNPCVEERSL---DGLLMDVLSA 79

  Fly    66 ------VLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVM 124
                  .|:::|.:.  .:.||.:.::..|.|||.|||.:.|.:..|::|.:.|.:|||||.:::
Zfish    80 SKRGVAALQADSDEC--NFDFTSSLFFVITFLTTTGYGTTVPLSDEGRVFCVVYCLVGIPLTMLL 142

  Fly   125 FQSIGER-VNRLSSYVIKAVRSSLRCKRTVASEVDLICVVTTLSSLTIAGGAAAFSKFE-GWSYF 187
            ...:... :.|::...|:.::......|:.|:.:....:....::|.....|||....| .|:|.
Zfish   143 LSCLTHALLPRVTHTPIQNLQLFWGLSRSNAALLHCSILGFCTAALFFLLPAAALCLLEDDWTYL 207

  Fly   188 DSVYYCFITLTTIGFGDMVALQRDN-ALNRKPEYVMFALIFILFGLAIVAASLNLLVLRFVTMNT 251
            :|:|:|||:|:|.|.||.:..:..| |:.:..|:|  ...::|.||.::     |:||       
Zfish   208 ESLYFCFISLSTTGLGDYLPGKIQNQAVRQGLEFV--TSCYLLLGLIVL-----LVVL------- 258

  Fly   252 EDERRDEAQAMQALQVAVKLEGDVITSNGSILSGYEGHDGQSLNGSNTSSMCSCHCICLNGNRHK 316
              |...|.|..||                 :|..:.|.....|||.:...      :.|.|:.  
Zfish   259 --ESFWELQQFQA-----------------VLRFFSGPRLSELNGLSLDE------LVLTGDM-- 296

  Fly   317 KSSNLEKNNDAENQYKL---------RQSP-THIRHLLPEV-VPMQDLNYDYDTQSL 362
                  ...:.|.||.|         ..|| |....|||.. :|....:.|||..||
Zfish   297 ------TGPEEEPQYTLPISTISPAFSDSPATPTIELLPVFGLPSIPASKDYDHSSL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 18/55 (33%)
Ion_trans_2 169..247 CDD:285168 27/79 (34%)
kcnk7NP_001373286.1 Ion_trans_2 <95..150 CDD:400301 18/54 (33%)
Ion_trans_2 <203..>227 CDD:400301 12/23 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.