DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnf1a

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001076280.1 Gene:kcnf1a / 557280 ZFINID:ZDB-GENE-041001-217 Length:494 Species:Danio rerio


Alignment Length:162 Identity:37/162 - (22%)
Similarity:67/162 - (41%) Gaps:49/162 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVMETVVL 67
            |.:::.:.|::   .|:.||..:|.||                     .|.:.|...:.|.|.:.
Zfish   321 KSSLKELGLLL---MYMSVGIFLFSAL---------------------GYTMEQSHPETMFTSIP 361

  Fly    68 KSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGERV 132
            :|              |::|...:||:|||...|.|..|:    |.|.|....|::   :|...:
Zfish   362 QS--------------FWWAIITMTTVGYGDIYPKTTLGR----CNAAVSFLCGVI---AIALPI 405

  Fly   133 NR-LSSYVIKAVRSSLRCKRTVAS-EVDLICV 162
            :. ::::||  |.|..|...|.|. |::|:.:
Zfish   406 HPIINNFVI--VYSKQRVLETAAKHEIELMAL 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 15/53 (28%)
Ion_trans_2 165..243 CDD:462301
kcnf1aNP_001076280.1 BTB_POZ_Kv5_KCNF1 21..136 CDD:349690
Ion_trans 184..420 CDD:459842 32/145 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.