DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and KCNK10

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_612190.1 Gene:KCNK10 / 54207 HGNCID:6273 Length:543 Species:Homo sapiens


Alignment Length:280 Identity:92/280 - (32%)
Similarity:145/280 - (51%) Gaps:40/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKQNVRTISLIVCTFTYLLVGAAVFDALES--ETEKRRWEALQDAEDMIIRKY-NISQEDFKVM 62
            ||.:.|  :::.|....||:.|..||.|||.  |:.::...||:.||  .:|.: .:|.::   :
Human    72 MKWKTV--VAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAE--FLRDHVCVSPQE---L 129

  Fly    63 ETVVLKS-ESHKAG-----------QQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAI 115
            ||::..: ::..||           ..|....||::|.||:||||||:..|||.|||:|.:.|||
Human   130 ETLIQHALDADNAGVSPIGNSSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAI 194

  Fly   116 VGIPLGLVMFQSIGERVNRLSSYVIKAVRSSLRCKRTVASEVDLICVVTTLSSLTIAGG------ 174
            .||||...:...||:::..:....|..|....|.|:...:::.:|..:     |.|..|      
Human   195 FGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVISTI-----LFILAGCIVFVT 254

  Fly   175 --AAAFSKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNA-LNRKPEYVMFALIFILFGLAIVA 236
              |..|...|||:..:|:|:..:||||:||||.||  ..|| :|.:..|......:||.|||..|
Human   255 IPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVA--GGNAGINYREWYKPLVWFWILVGLAYFA 317

  Fly   237 ASLNLL--VLRFVTMNTEDE 254
            |.|:::  .||.::..|::|
Human   318 AVLSMIGDWLRVLSKKTKEE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 28/54 (52%)
Ion_trans_2 169..247 CDD:285168 34/88 (39%)
KCNK10NP_612190.1 Ion_trans_2 153..211 CDD:285168 28/57 (49%)
Ion_trans_2 249..328 CDD:285168 29/80 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155117
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2827
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.