DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and KCNK9

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_011515403.1 Gene:KCNK9 / 51305 HGNCID:6283 Length:401 Species:Homo sapiens


Alignment Length:257 Identity:151/257 - (58%)
Similarity:190/257 - (73%) Gaps:0/257 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVMETV 65
            ||:|||||:||||||||||||||||||||||:.|.|..|.|:..|..|..|||||.||::.:|.|
Human     1 MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELV 65

  Fly    66 VLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGE 130
            :|:||.|:||.||||.|:||:|.||:|||||||:.|.|..||.|.|.||::||||.||||||:||
Human    66 ILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGE 130

  Fly   131 RVNRLSSYVIKAVRSSLRCKRTVASEVDLICVVTTLSSLTIAGGAAAFSKFEGWSYFDSVYYCFI 195
            |:|....|::|.::.....:.|..|..:::.|.......|:..||||||:.|.||:|.:.|||||
Human   131 RMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFI 195

  Fly   196 TLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASLNLLVLRFVTMNTEDERRD 257
            |||||||||.||||...||.:||.||.|:.::||.||.::.|.|||:||||:|||:||||||
Human   196 TLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 37/54 (69%)
Ion_trans_2 169..247 CDD:285168 47/77 (61%)
KCNK9XP_011515403.1 Ion_trans_2 <77..132 CDD:285168 37/54 (69%)
Ion_trans_2 170..243 CDD:285168 44/72 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155123
Domainoid 1 1.000 110 1.000 Domainoid score I6296
eggNOG 1 0.900 - - E1_KOG4404
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 314 1.000 Inparanoid score I2564
Isobase 1 0.950 - 0 Normalized mean entropy S2198
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1109218at2759
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 1 1.000 - - mtm8575
orthoMCL 1 0.900 - - OOG6_103570
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2827
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.