DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and KCNK4

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001304019.1 Gene:KCNK4 / 50801 HGNCID:6279 Length:393 Species:Homo sapiens


Alignment Length:286 Identity:80/286 - (27%)
Similarity:132/286 - (46%) Gaps:65/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYN-ISQEDFKVM---------- 62
            ::|:.....||:.||.||.|||...|::....|.:..:..:|.:. :|.::..::          
Human     7 LALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGG 71

  Fly    63 ----ETVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLV 123
                ||....:.||.|   |....||:::.|::||||||:....|..|:||.:.||:|||||..:
Human    72 GADPETNSTSNSSHSA---WDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGI 133

  Fly   124 MFQSIGERVNRLSSYVIKAVRSSLR------------------CKRTVASEVDLI--CVVTTLSS 168
            :...:|:|:.           ||||                  ..|.:::.:.|:  |::..|:.
Human   134 LLAGVGDRLG-----------SSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTP 187

  Fly   169 LTIAGGAAAFSKFEGWSYFDSVYYCFITLTTIGFGDMVA---LQRDNALNRKPEYVMFALIFILF 230
            ..:      |...|.||..:::|:..:||||:||||.||   .::|:     |.|......:||.
Human   188 TFV------FCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDS-----PAYQPLVWFWILL 241

  Fly   231 GLAIVAASLNLL--VLRFVTMNTEDE 254
            |||..|:.|..:  .||.|:..|..|
Human   242 GLAYFASVLTTIGNWLRVVSRRTRAE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 22/54 (41%)
Ion_trans_2 169..247 CDD:285168 27/82 (33%)
KCNK4NP_001304019.1 Ion_trans_2 <88..142 CDD:400301 22/53 (42%)
Selectivity filter 1. /evidence=ECO:0000269|PubMed:22282805, ECO:0000269|PubMed:23341632, ECO:0000269|PubMed:25471887, ECO:0000269|PubMed:25500157 103..108 4/4 (100%)
Ion_trans_2 180..258 CDD:400301 27/88 (31%)
Selectivity filter 2. /evidence=ECO:0000269|PubMed:22282805, ECO:0000269|PubMed:23341632, ECO:0000269|PubMed:25471887, ECO:0000269|PubMed:25500157 212..217 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..393
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155137
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.