DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnk6

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001025245.2 Gene:kcnk6 / 504083 ZFINID:ZDB-GENE-050309-213 Length:315 Species:Danio rerio


Alignment Length:284 Identity:79/284 - (27%)
Similarity:138/284 - (48%) Gaps:38/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISLIVCTFTYLLVGAAVFDALESETEKRRWEALQ-DAEDMIIRKYNISQEDFKVMETV---VLKS 69
            |..|:..|||||:||.||.|:|...|    |:|: |...:.....|:|..:...:||.   |||:
Zfish    12 IGFILAYFTYLLLGALVFSAIERPIE----ESLKADLSSLKAEFLNLSCVNSTALETFLERVLKA 72

  Fly    70 --------ESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQ 126
                    |:......|....:.::|.|::||:||||:||.:..||.|::.||::|:|..:::..
Zfish    73 NKYGVSVLENASLRTNWDLASSLFFANTMVTTVGYGHTTPLSDAGKAFSIVYALIGVPFTMLVLT 137

  Fly   127 SIGERVNRLSSY-VIKAVRSSLRCKRTVASEVDLICVVTTLSSLTIAGGAAAFSKF-EGWSYFDS 189
            :..:|:....:| .|.|.:.....::..||.|..|.::..:........:..||.. |.||:.|:
Zfish   138 ACVQRLMHPLTYRPISACQRRAGLQQRSASVVHFIVLLFLVVLCFFVVPSLVFSAIEETWSFLDA 202

  Fly   190 VYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASLNLLVLR--------- 245
            .|:|||:|.|||.||.|..::... :.:..|.:..::::..||.::     .||||         
Zfish   203 FYFCFISLCTIGLGDFVPAEKPGQ-SLRALYKISVMVYLFVGLMVM-----FLVLRTFHKLADVY 261

  Fly   246 -----FVTMNTEDERRDEAQAMQA 264
                 |...:.|::..|:...::|
Zfish   262 GWTAFFHLPSCEEDEEDKEPIIEA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 18/54 (33%)
Ion_trans_2 169..247 CDD:285168 24/92 (26%)
kcnk6NP_001025245.2 Ion_trans_2 84..145 CDD:285168 19/60 (32%)
Ion_trans_2 178..254 CDD:285168 24/81 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.