DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnk1

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001011490.1 Gene:kcnk1 / 496985 XenbaseID:XB-GENE-5846322 Length:330 Species:Xenopus tropicalis


Alignment Length:250 Identity:79/250 - (31%)
Similarity:129/250 - (51%) Gaps:28/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYN-ISQEDFKVMETVVLKSESH 72
            :.|::....:||:|||:|.|:|...|....|.|.|.:...:::.. :|:|..:...:.||::.::
 Frog    24 VLLMLGYLLFLLIGAAIFSAVELPHEHVLREELLDLKHRYLQENECLSEERLESFLSRVLEASNY 88

  Fly    73 --------KAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIG 129
                    .....|.||.|.::.:|||:|.||||:.|.:..||.|.:.|:|:||||.|::|.::.
 Frog    89 GVSMLNNVSGNPNWDFTSALFFVSTVLSTTGYGHTVPLSNAGKTFCIIYSIIGIPLTLLLFTALV 153

  Fly   130 ERV-----NRLSSYVIKAVRSSLRC---KRTVASEVDLIC-VVTTLSSLTIAGGAAAFSKFE-GW 184
            :|:     :|..||.      .||.   |:|||....|:. .|..|....|.  ||.||..| .|
 Frog   154 QRIMVHVTHRPISYF------HLRWGYNKQTVAVVHALVIGFVAILCFFLIP--AAIFSALEDDW 210

  Fly   185 SYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASL 239
            ::.:|.|:|||:|:|||.||.|..:..|...|: .|......:::.||.::...|
 Frog   211 NFLESFYFCFISLSTIGLGDYVPAEGQNQRYRQ-LYKFGITCYLILGLIVMLVVL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 24/54 (44%)
Ion_trans_2 169..247 CDD:285168 24/71 (34%)
kcnk1NP_001011490.1 Ion_trans_2 <101..157 CDD:311712 25/55 (45%)
Ion_trans_2 192..267 CDD:311712 25/75 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.