DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcnk18

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001003820.1 Gene:Kcnk18 / 445371 RGDID:1303091 Length:405 Species:Rattus norvegicus


Alignment Length:359 Identity:88/359 - (24%)
Similarity:131/359 - (36%) Gaps:138/359 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKY-----NISQEDFKVME----- 63
            :..:.|..||.|||||:|.|:|...:.   ||.::.|   ::|:     ||.:.:..|:|     
  Rat    46 LCFLCCLVTYALVGAALFSAVEGRPDP---EAEENPE---LKKFLDKLCNILKCNLTVVEGSRKD 104

  Fly    64 ----TVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVM 124
                ...||.:..||.:.|.|..|.::..||.:|:||||..|.|..||...|.||:.||||..::
  Rat   105 LCEHLQQLKPQWFKAPEDWSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLV 169

  Fly   125 FQSIGERVNRLSSYV-------------IKAVRSSLRCK-------------------------- 150
            ...||:.:..:.|..             |...|..|.|:                          
  Rat   170 LTDIGDILAAILSRAYSRFQALLCLPRDISKWRPLLLCRKQTDSKPADEAIPQIVIDAGADELLD 234

  Fly   151 ------------------RTVASEVD-----------------------LICVVTTLSSLTIAGG 174
                              |.||.|..                       |.|.:  ||:|...|.
  Rat   235 PQPSREPASPSCNVELFERLVAREKQNELQPPMRPVERSNSCPELVLGRLSCSI--LSNLDEVGQ 297

  Fly   175 ----------------------AAAFSKFEGW----SYFDSVYYCFITLTTIGFGDMVALQRDNA 213
                                  |||...|  |    .:.|:.|:||:|||||||||:|.:.    
  Rat   298 QVERLDIPLPVIALVIFAYISCAAAILPF--WETDLGFEDAFYFCFVTLTTIGFGDIVLVH---- 356

  Fly   214 LNRKPEYVMFALIFILFGLAIVAASLNLLVLRFV 247
                |.:.:|..|:|:.|:.|:..:..|:..|.:
  Rat   357 ----PHFFLFFSIYIIVGMEILFIAFKLMQNRLL 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 23/54 (43%)
Ion_trans_2 169..247 CDD:285168 29/103 (28%)
Kcnk18NP_001003820.1 Ion_trans_2 116..177 CDD:285168 25/60 (42%)
Interaction with calcineurin. /evidence=ECO:0000250 221..226 0/4 (0%)
Interaction with YWHAH. /evidence=ECO:0000250 272..277 0/4 (0%)
Ion_trans_2 311..387 CDD:285168 27/86 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349017
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.