DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and CG10864

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_650726.1 Gene:CG10864 / 42222 FlyBaseID:FBgn0038621 Length:389 Species:Drosophila melanogaster


Alignment Length:347 Identity:81/347 - (23%)
Similarity:131/347 - (37%) Gaps:102/347 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQNVRTISLIVCT--------FTYLLVGAAVFDALE----SET---------------------- 33
            |:..|.....:||        ..|.:.||..|..:|    .||                      
  Fly    37 KRCCRNFVTFMCTQVGVGALIVIYAICGAFAFMHIERQFVDETAGHVMELRQNCSQQLWSITEQH 101

  Fly    34 ---EKRRW-EALQDAEDMIIRKYNISQEDFKVMETVVLKSESHKAGQQWKFTGAFYYATTVLTTI 94
               ::||| ||..|    ::|:|. ||....|....|.:|..    |.|.|..|..:..:|:|.|
  Fly   102 NIIDRRRWTEATND----VLREYQ-SQIAGVVKHGYVGRSPE----QIWSFPAALMFCLSVITMI 157

  Fly    95 GYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGERVNRLSSYVIKAVRS-------------- 145
            |||:..|.|..||.||:.||..||||.::.|.::|..:.|...::.:::..              
  Fly   158 GYGNMVPRTPWGKGFTVIYATFGIPLYILYFLNMGRVLARSFKFLYRSLHDCTQEHPRLDRMDAL 222

  Fly   146 ----SLRCKRTVASEVDLICVVTTLSSLTIAGGAAAFSKFEGWSYFDSVYYCFITLTTIGFGDMV 206
                .:..|:.:......:.|:    ...:..|...|:.:|.||..:|.|:|..:|..|||||.|
  Fly   223 EGGVGMTRKKVIVPSTACLWVI----FFYVLTGTVMFANWEKWSLLNSFYFCMTSLCKIGFGDFV 283

  Fly   207 ----------------ALQRDNALNRKP------------EYVMFAL--IFILFGLAIVAASLNL 241
                            .||.|  ::..|            ::...|:  :::|.|:.:||...||
  Fly   284 PGASLTTSADVNAATQKLQED--ISADPAELAQLQSVAADQHSKLAINFVYMLLGMGLVAMCRNL 346

  Fly   242 LVLRFVTMNTEDERRDEAQAMQ 263
            : ...|.:...:.|.|....|:
  Fly   347 M-REEVRLKAREMREDAKLCME 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 23/54 (43%)
Ion_trans_2 169..247 CDD:285168 26/107 (24%)
CG10864NP_650726.1 Ion_trans_2 124..197 CDD:285168 27/76 (36%)
Ion_trans_2 242..>284 CDD:285168 15/45 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461296
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.