DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnk5b

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_956927.1 Gene:kcnk5b / 393606 ZFINID:ZDB-GENE-040426-1297 Length:448 Species:Danio rerio


Alignment Length:238 Identity:78/238 - (32%)
Similarity:115/238 - (48%) Gaps:38/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYN-ISQEDF-KVMETVVLKSESHKAGQ---- 76
            ||.:|||:|..||........:..::..:.:::||. :|:|.. :::|.|     :...||    
Zfish    15 YLSIGAAIFQILEEPNLNSAVDDYKNKTNNLLKKYPCLSKEVLGEIIEVV-----AEATGQGVTV 74

  Fly    77 -------QWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSI----GE 130
                   .|.:..|..:|.||:||||||:..|.|.||:||.:.|.:.||||.|.....:    |.
Zfish    75 TKEAQFNNWNWENAVIFAATVITTIGYGNVAPKTTGGRLFCILYGLCGIPLCLTWISELGTFFGS 139

  Fly   131 RVNRLSSYVIKAVRSSLRCKRTVASEVDLICVVT-----TLSSLTIAGGAAAFSKFEGWSYFDSV 190
            |..|||..::   .|.|..::     |..||.:.     .|..|.|.  |..|..||.|:|.:.:
Zfish   140 RTKRLSQLLL---HSGLNVRK-----VQFICTIVFLLWGFLVHLIIP--AFVFMFFENWTYLEGL 194

  Fly   191 YYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLA 233
            |:.|.||||:||||.|| ..|.::|....|..|..::|..|||
Zfish   195 YFSFTTLTTVGFGDYVA-GVDPSVNYPTLYRFFVQLWIYLGLA 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 24/58 (41%)
Ion_trans_2 169..247 CDD:285168 28/65 (43%)
kcnk5bNP_956927.1 Ion_trans_2 <81..137 CDD:285168 23/55 (42%)
Ion_trans <142..234 CDD:278921 34/102 (33%)
Ion_trans_2 171..243 CDD:285168 29/69 (42%)
C_Hendra 258..>323 CDD:293426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590218
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.