DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and KCNS2

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_065748.1 Gene:KCNS2 / 3788 HGNCID:6301 Length:477 Species:Homo sapiens


Alignment Length:150 Identity:34/150 - (22%)
Similarity:57/150 - (38%) Gaps:50/150 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVMETVVL 67
            |.:.:.:.|::   .||.||.::|..:                     .|.|.:|:.:.:.|:  
Human   323 KYSYKEVGLLL---LYLSVGISIFSVV---------------------AYTIEKEENEGLATI-- 361

  Fly    68 KSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI-----PLGLVM--F 125
                         ...:::||..:||:|||...|.|..|||......:.||     |:.|:.  |
Human   362 -------------PACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKF 413

  Fly   126 QSIGERVNRLSSYVIKAVRS 145
            .....|..:|.|    |:||
Human   414 SHFYRRQKQLES----AMRS 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 17/60 (28%)
Ion_trans_2 165..243 CDD:462301
KCNS2NP_065748.1 BTB_POZ_KCNS2 18..124 CDD:349734
Ion_trans 186..421 CDD:459842 29/136 (21%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 374..379 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.