DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and KCNA5

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_002225.2 Gene:KCNA5 / 3741 HGNCID:6224 Length:613 Species:Homo sapiens


Alignment Length:118 Identity:24/118 - (20%)
Similarity:45/118 - (38%) Gaps:46/118 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NVRTISLIVCTFTYLLVGAAVFDA----LESETEKRRWEALQDAEDMIIRKYNISQEDFKVMETV 65
            ::|.:.|::   .:|.:|..:|.:    .|::.:...:.::.|                      
Human   430 SMRELGLLI---FFLFIGVILFSSAVYFAEADNQGTHFSSIPD---------------------- 469

  Fly    66 VLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI 118
                             ||::|...:||:|||...|.|||||:.....||.|:
Human   470 -----------------AFWWAVVTMTTVGYGDMRPITVGGKIVGSLCAIAGV 505

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 17/41 (41%)
Ion_trans_2 165..243 CDD:462301
KCNA5NP_002225.2 Tetramerization domain. /evidence=ECO:0000305|PubMed:20018952 1..211
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..108
2 X 11 AA tandem repeat of D-[SP]-G-V-R-P-L-P-P-L-P 61..82
BTB_POZ 120..246 CDD:453885
Ion_trans 249..526 CDD:459842 24/118 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..304