DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and CG1688

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_610516.1 Gene:CG1688 / 36005 FlyBaseID:FBgn0027589 Length:918 Species:Drosophila melanogaster


Alignment Length:167 Identity:43/167 - (25%)
Similarity:69/167 - (41%) Gaps:45/167 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVM---------- 62
            |..|::....|.::|..:|..||:..:..:..|:..:.:..:|:..|..|...|:          
  Fly    76 TPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVH 140

  Fly    63 -------ETVVLKSESHKAG----------------------------QQWKFTGAFYYATTVLT 92
                   .::|..:....||                            |.|.|:.|..|:.||:|
  Fly   141 EQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVIT 205

  Fly    93 TIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIG 129
            |||:|..||.|..|||.|:.||:||:||.|:...|:|
  Fly   206 TIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 27/53 (51%)
Ion_trans_2 169..247 CDD:285168
CG1688NP_610516.1 Ion_trans_2 <191..247 CDD:285168 27/52 (52%)
Ion_trans_2 822..896 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461306
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
65.940

Return to query results.
Submit another query.