Sequence 1: | NP_001262541.1 | Gene: | Task6 / 41671 | FlyBaseID: | FBgn0038165 | Length: | 408 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001022681.1 | Gene: | twk-48 / 3565640 | WormBaseID: | WBGene00010784 | Length: | 372 | Species: | Caenorhabditis elegans |
Alignment Length: | 321 | Identity: | 86/321 - (26%) |
---|---|---|---|
Similarity: | 136/321 - (42%) | Gaps: | 88/321 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 ISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMII-----RKYNISQEDFKVMETVVLK 68
Fly 69 S----------------ESHKAGQ--QWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAI 115
Fly 116 VGIPLGLVMFQSIGE------------------------------RVNRLSSYVIKAVR------ 144
Fly 145 -------------------------SSLRCKRTVASEVDLICVVTTLSSLTIAG----GAAAFSK 180
Fly 181 FEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASLNL 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Task6 | NP_001262541.1 | Ion_trans_2 | <77..132 | CDD:285168 | 31/84 (37%) |
Ion_trans_2 | 169..247 | CDD:285168 | 29/77 (38%) | ||
twk-48 | NP_001022681.1 | Ion_trans_2 | <117..176 | CDD:285168 | 31/58 (53%) |
Ion_trans_2 | 272..355 | CDD:285168 | 29/77 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000030 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |