Sequence 1: | NP_001262541.1 | Gene: | Task6 / 41671 | FlyBaseID: | FBgn0038165 | Length: | 408 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_872137.2 | Gene: | twk-43 / 3565024 | WormBaseID: | WBGene00006693 | Length: | 597 | Species: | Caenorhabditis elegans |
Alignment Length: | 312 | Identity: | 66/312 - (21%) |
---|---|---|---|
Similarity: | 118/312 - (37%) | Gaps: | 96/312 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 IRKYNISQ-------------EDFKVMETVVLKSESHKAG-----------------QQWKFTGA 83
Fly 84 FYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGE-RVNRLSSYV-------- 139
Fly 140 ---------------IKAVRSSLRCKRTVASEVD-----------------------LICVVTTL 166
Fly 167 SSLTIAGGAAAFSKF-EGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILF 230
Fly 231 GLAIVAASLNLLVLRFVTMNTEDERRDEAQAMQ--------ALQVAVKLEGD 274 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Task6 | NP_001262541.1 | Ion_trans_2 | <77..132 | CDD:285168 | 20/55 (36%) |
Ion_trans_2 | 169..247 | CDD:285168 | 21/78 (27%) | ||
twk-43 | NP_872137.2 | Ion_trans_2 | <162..218 | CDD:285168 | 20/55 (36%) |
Ion_trans_2 | 298..372 | CDD:285168 | 22/83 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X19 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |