DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcnk18

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_997144.1 Gene:Kcnk18 / 332396 MGIID:2685627 Length:394 Species:Mus musculus


Alignment Length:358 Identity:84/358 - (23%)
Similarity:125/358 - (34%) Gaps:136/358 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKY-----NISQEDFKVME----- 63
            :..:.|..||.|||||:|.|:|...:.   ||.::.|   ::|:     ||.:.:..|:|     
Mouse    35 LCFLCCLVTYALVGAALFSAVEGRPDP---EAEENPE---LKKFLDDLCNILKCNLTVVEGSRKN 93

  Fly    64 ----TVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVM 124
                ...||.:..||.|.|.|..|.::..||.:|:||||..|.|..||...|.||:.||||..::
Mouse    94 LCEHLQHLKPQWLKAPQDWSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLV 158

  Fly   125 FQSIG------------------------------------------------------------ 129
            ...||                                                            
Mouse   159 LTDIGDILATILSRAYSRFQALLCLPHDIFKWRSLPLCRKQPDSKPVEEAIPQIVIDAGVDELLN 223

  Fly   130 -----------------------ERVNRLSSYVIKAVRSSLRCKRTV------------------ 153
                                   |:.|:|.. ..:.|..|..|...|                  
Mouse   224 PQPSKDPPSPSCNVELFERLVAREKKNKLQP-PTRPVERSNSCPELVLGRLSCSILSNLDEVGQQ 287

  Fly   154 ASEVDLICVVTTLSSLTIAGGAAAFSKFEGW----SYFDSVYYCFITLTTIGFGDMVALQRDNAL 214
            ...:|:...|..|........|||...|  |    .:.|:.|:||:|||||||||:|.:.     
Mouse   288 VERLDIPLPVIALVVFAYISCAAAILPF--WETELGFEDAFYFCFVTLTTIGFGDIVLVH----- 345

  Fly   215 NRKPEYVMFALIFILFGLAIVAASLNLLVLRFV 247
               |.:.:|..|:|:.|:.|:..:..|:..|.:
Mouse   346 ---PHFFLFFSIYIIVGMEILFIAFKLMQNRLL 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 24/137 (18%)
Ion_trans_2 169..247 CDD:285168 27/81 (33%)
Kcnk18NP_997144.1 Ion_trans_2 <111..166 CDD:285168 23/54 (43%)
Interaction with calcineurin 210..215 0/4 (0%)
Interaction with YWHAH. /evidence=ECO:0000269|PubMed:18397886 261..266 1/4 (25%)
Ion_trans_2 300..376 CDD:285168 28/86 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845603
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.