DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Sh

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_728123.1 Gene:Sh / 32780 FlyBaseID:FBgn0003380 Length:655 Species:Drosophila melanogaster


Alignment Length:120 Identity:25/120 - (20%)
Similarity:46/120 - (38%) Gaps:46/120 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQNVRTISLIVCTFTYLLVGAAVFDA----LESETEKRRWEALQDAEDMIIRKYNISQEDFKVME 63
            |.::|.:.|::   .:|.:|..:|.:    .|:.:|...::::.|                    
  Fly   390 KASMRELGLLI---FFLFIGVVLFSSAVYFAEAGSENSFFKSIPD-------------------- 431

  Fly    64 TVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI 118
                               ||::|...:||:|||..||..|.||:.....||.|:
  Fly   432 -------------------AFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGV 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 16/41 (39%)
Ion_trans_2 165..243 CDD:462301
ShNP_728123.1 BTB_POZ 97..223 CDD:453885
Ion_trans 226..488 CDD:459842 25/120 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.