DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcnf1

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001162575.1 Gene:Kcnf1 / 298908 RGDID:631414 Length:505 Species:Rattus norvegicus


Alignment Length:123 Identity:30/123 - (24%)
Similarity:46/123 - (37%) Gaps:43/123 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVMETVVL 67
            |::.:.:.|::   .||.||..||.||....|:...|.|                 ||       
  Rat   330 KRSFKELGLLL---MYLAVGIFVFSALGYTMEQSHPETL-----------------FK------- 367

  Fly    68 KSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFT----MCYAI-VGIPL 120
                       ....:|::|...:||:|||...|.|..|||..    :|..| :.:|:
  Rat   368 -----------SIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPI 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 15/48 (31%)
Ion_trans_2 165..243 CDD:462301
Kcnf1NP_001162575.1 BTB_POZ_Kv5_KCNF1 35..150 CDD:349690
Ion_trans 193..429 CDD:459842 30/123 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.