DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcna3

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_062143.3 Gene:Kcna3 / 29731 RGDID:2951 Length:525 Species:Rattus norvegicus


Alignment Length:120 Identity:24/120 - (20%)
Similarity:45/120 - (37%) Gaps:46/120 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQNVRTISLIVCTFTYLLVGAAVFDA----LESETEKRRWEALQDAEDMIIRKYNISQEDFKVME 63
            |.::|.:.|::   .:|.:|..:|.:    .|::.....:.::.|                    
  Rat   342 KASMRELGLLI---FFLFIGVILFSSAVYFAEADDPSSGFNSIPD-------------------- 383

  Fly    64 TVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI 118
                               ||::|...:||:|||...|.|:|||:.....||.|:
  Rat   384 -------------------AFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGV 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 16/41 (39%)
Ion_trans_2 165..243 CDD:462301
Kcna3NP_062143.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
BTB_POZ 54..180 CDD:453885
Ion_trans 183..440 CDD:459842 24/120 (20%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 394..399 3/4 (75%)
Interaction with KCNE4. /evidence=ECO:0000269|PubMed:27802162 432..525
PDZ-binding. /evidence=ECO:0000269|PubMed:7477295 523..525
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.