DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcnc2

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_631963.1 Gene:Kcnc2 / 246153 RGDID:628829 Length:638 Species:Rattus norvegicus


Alignment Length:93 Identity:25/93 - (26%)
Similarity:38/93 - (40%) Gaps:7/93 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ETVVLKSESHKAGQQWKFTG---AFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVM 124
            |.|..:.....|.:..:|..   .|::|...:||:|||...|.|..|.|.....|:.|:   |.:
  Rat   404 ERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGV---LTI 465

  Fly   125 FQSIGERVNRLSSYVIKAV-RSSLRCKR 151
            ...:...||....|...|: :..|..||
  Rat   466 AMPVPVIVNNFGMYYSLAMAKQKLPRKR 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 15/56 (27%)
Ion_trans_2 165..243 CDD:462301
Kcnc2NP_631963.1 BTB_KCNC2_4 7..166 CDD:349722
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..75
Ion_trans 228..484 CDD:459842 21/82 (26%)
Selectivity filter. /evidence=ECO:0000250 437..442 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 538..572
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.