DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcns3

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_775593.1 Gene:Kcns3 / 238076 MGIID:1098804 Length:491 Species:Mus musculus


Alignment Length:127 Identity:31/127 - (24%)
Similarity:46/127 - (36%) Gaps:44/127 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVMETVVLKSESHKAGQQWKFTG 82
            :|.||.::|..|....||                                  :.||:    ..|.
Mouse   330 FLSVGISIFSVLIYSVEK----------------------------------DEHKS----SLTS 356

  Fly    83 ---AFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGERVNRLSSYVIK 141
               .:::||..:||:|||.:.|.|:.||:......|.||   ||:...|....|:.|.|..|
Mouse   357 IPICWWWATISMTTVGYGDTHPVTLAGKIIASTCIICGI---LVVALPITIIFNKFSKYYQK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 18/56 (32%)
Ion_trans_2 165..243 CDD:462301
Kcns3NP_775593.1 BTB_POZ_KCNS3 15..122 CDD:349735
Ion_trans 184..417 CDD:459842 31/127 (24%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 370..375 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.