DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcnk13

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001157898.1 Gene:Kcnk13 / 217826 MGIID:2384976 Length:405 Species:Mus musculus


Alignment Length:382 Identity:111/382 - (29%)
Similarity:185/382 - (48%) Gaps:78/382 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKQNVRTISLIVCTFTYLLVGAAVFDALESETE---KRRWEALQDAEDMIIRKYNISQEDFKVM 62
            :.:.|.|.:.|......|||.|||||.|||...|   |:|||   :......|.:|:|:|:.:..
Mouse    13 LNEDNARFLLLAGLILLYLLGGAAVFSALELAQELQAKQRWE---ERLANFSRGHNLSREELRGF 74

  Fly    63 ETVVLK--SESHKAG-------QQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI 118
                |:  .|:.:||       .:|.||||||:..||::|||:|.:||:|.|||:|.:.|.::|.
Mouse    75 ----LRHYEEATRAGIRMDSVRPRWDFTGAFYFVGTVVSTIGFGMTTPATTGGKIFLIFYGLIGC 135

  Fly   119 PLGLVMFQSIGERVNRLSSYVIKAV-RSSLRCKRTVASE-------------------VDLICVV 163
            ...::.|....||:..:.:.|:::. :..||.:..|..:                   |..:.::
Mouse   136 ASTILFFNLFLERLITVIACVMRSCHQQQLRRRGAVTQDNMKAPEKGEADSLTGWKPSVYYVMLI 200

  Fly   164 TTLSSLTIAGGAAA-FSKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPE----YVMF 223
            ..|:|:.|:.||:| ::..||||||||||:||:..:||||||:|:.|     |.:.|    |..|
Mouse   201 LCLASVAISCGASALYTTMEGWSYFDSVYFCFVAFSTIGFGDLVSSQ-----NAQYESQGLYRFF 260

  Fly   224 ALIFILFGLAIVAASLNLL-VLRFVTMNTEDERRDEA------QAMQALQVAVKLEGDV------ 275
            ....||.|:..:.:..|:: :|...|:|....:.|..      :.:...:..|.:.|::      
Mouse   261 NFFLILMGVCCIYSLFNVISILIKQTVNWILRKLDSGCFPPCQRGLLRSRRNVVMPGNIRNRCNI 325

  Fly   276 -ITSNGSILSGYEGHDGQSLNGSNTSSMCSCHCICL-----------NGNRHKKSSN 320
             |.::|.:.|   ..||:.|:| ...||...:.:.|           ||..|:.|::
Mouse   326 SIETDGVMES---DTDGRRLSG-EMISMKDTNKVSLAILQKQLSEMANGGPHQNSAS 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 24/54 (44%)
Ion_trans_2 169..247 CDD:285168 33/83 (40%)
Kcnk13NP_001157898.1 Ion_trans_2 88..150 CDD:400301 25/61 (41%)
Ion_trans_2 203..285 CDD:400301 35/86 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845579
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.