DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and twk-4

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001343566.1 Gene:twk-4 / 192079 WormBaseID:WBGene00006659 Length:418 Species:Caenorhabditis elegans


Alignment Length:315 Identity:82/315 - (26%)
Similarity:146/315 - (46%) Gaps:59/315 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIVCTFTYLLVGAAVFDALESETEKRRWE-------------------ALQDAEDMIIRKYNIS- 55
            ||..|..|::.||.:|..:|.:.|..|::                   ::.|.|::|....:|: 
 Worm    94 LIFATVAYIIAGAYLFTKIEHQAELDRYQSYHTIYRNFINNLYQSSNRSVADVENLIDTFTSINF 158

  Fly    56 ---QEDFKVMETVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVG 117
               :|..|..:.:|.:..|     :|....|.::.|||||:||||:..|.:.|||:|.:.|||.|
 Worm   159 RAFKEGLKPTDFLVPQETS-----RWSMISAIFFTTTVLTSIGYGNLIPISTGGKIFCVGYAIFG 218

  Fly   118 IPLGLVMFQSIGERVNRLSSYVIKAVRSSLRCKRTVASEVDLICVVTTLSSLTIAGGAAAFSKFE 182
            |||.||   :|.:....::..:|.......:..|      .|:.:|..|..:||:  |..::..|
 Worm   219 IPLTLV---TIADLAKFVADMLIMDPTEDPKTGR------QLLVLVFLLGYMTIS--ACVYTILE 272

  Fly   183 G-WSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKP----EYVMFALIFILFGLAIVAASLNLL 242
            . ||:.||.|:|.::|.|:||||:           .|    ||::.:::||..||.:...::::.
 Worm   273 PMWSFLDSFYFCLVSLLTVGFGDL-----------HPVGTVEYMLCSIVFIFIGLILTTLAVDVS 326

  Fly   243 -VLRFVTMNTEDERRDEAQAMQALQVAVKLEGDVITSNGSILSGYEGHDGQSLNG 296
             .:....|::.....|..:.:.||:|.   :.:.:......||......|:.|:|
 Worm   327 GSVGIAKMHSIGRGFDAMKMLNALRVR---KSEFVAKGAVSLSAAARVAGRRLDG 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 26/54 (48%)
Ion_trans_2 169..247 CDD:285168 23/83 (28%)
twk-4NP_001343566.1 Ion_trans_2 <178..235 CDD:311712 26/59 (44%)
Ion_trans_2 255..329 CDD:311712 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.