DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and twk-21

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_510654.2 Gene:twk-21 / 192078 WormBaseID:WBGene00006674 Length:581 Species:Caenorhabditis elegans


Alignment Length:319 Identity:80/319 - (25%)
Similarity:142/319 - (44%) Gaps:88/319 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VRTISLIVCTFTYLLVGAAVFDALESETEKRRWEA---LQDAEDMI--------IRKYNISQEDF 59
            :|.|.||:....|..:|..:|.|||.:.::...||   ::.:|..:        :::.|..|.:.
 Worm   132 IRYIMLILIILGYACLGGYMFQALEYDQQQLELEAEKRVRLSESSLLAVNLLEHLKQMNCGQSNE 196

  Fly    60 K-----VMETVVLKSESHKA-GQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI 118
            |     :.:|.:.:|:..:. |.:|.|..:.:::.|:.||||||:....|..|::.|:.|.::||
 Worm   197 KRCLELITKTFIQRSDEERGEGWRWDFWNSVFFSATIFTTIGYGNLACKTNLGRIATIIYGMIGI 261

  Fly   119 PLGLVMFQSIGERVNRLSSYVIKAVRSSL-RC-----KR--TVAS--------------EVD--- 158
            ||.|.:.::.||...:.:..:...|:..| :|     ||  ::||              |.|   
 Worm   262 PLMLFVLKNFGELCVKWAKKIQFNVQQCLKKCFGRKQKRASSLASITSKEMLEVFFEVPEDDKED 326

  Fly   159 ----------LICVVTTLSSLTIAGGAAAFSKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNA 213
                      :|.:...|.|..:       |.:|.|.:..:.|:.|::|:||||||:|       
 Worm   327 TTFQLRWGLLVIVLFVVLCSFVV-------SFWENWDFLTAFYFFFVSLSTIGFGDIV------- 377

  Fly   214 LNRKPEY-----VMFALIFILFGLAIVAASLNLLVLRFVTMNTEDERRDEAQAMQALQV 267
                |::     .:|.|.||  |||:.|....:|           :.|.|.|.|.||::
 Worm   378 ----PDHPRTACALFVLYFI--GLALFAMVYAIL-----------QERVENQYMWALEL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 20/54 (37%)
Ion_trans_2 169..247 CDD:285168 23/82 (28%)
twk-21NP_510654.2 Ion_trans_2 <219..277 CDD:285168 20/57 (35%)
Ion_trans_2 345..411 CDD:285168 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163774
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.