DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and twk-32

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_506416.2 Gene:twk-32 / 192075 WormBaseID:WBGene00006684 Length:614 Species:Caenorhabditis elegans


Alignment Length:380 Identity:84/380 - (22%)
Similarity:139/380 - (36%) Gaps:129/380 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISLIVCTFTYLLVG----------------AAVFDALESETEKR--------RWEALQDAEDMII 49
            |:|:|.:..|.:.|                |.:||.......||        .:|::.|  :::.
 Worm    37 ITLLVVSILYAVFGGWMLTLIKYSQQTTHQAIMFDQTRQNFAKRLALIGNKEEFESIVD--ELVE 99

  Fly    50 RKYNISQEDFKVMETVVLKSESHKAGQQWK-----------FTGAFYYATTVLTTIGYGHSTPST 103
            :.|     ||..||.          |.:|:           ||...::|.|.||:||||...|.:
 Worm   100 KTY-----DFYTMED----------GHRWQEAAFNANPLTNFTSNLFFAATTLTSIGYGIDAPES 149

  Fly   104 VGGKLFTMCYAIVGIPLGLV----MFQSIGERVNRLSSYVIK-AVRSSLRCKRTVASEVDLICVV 163
            :.|::|.:.|...||||.|:    |.:...|.:||..:.:|| ..|...|.||..:..:....: 
 Worm   150 LIGRVFCLVYLFFGIPLYLITIADMAKFCTELMNRTYTEIIKYKYRVKRRYKRWKSGRIRRESM- 213

  Fly   164 TTLSSLTIAGGAAAFSKF------------------------------------EGWSYFDSVYY 192
             .:..:.||||....::|                                    |.|:..|..|:
 Worm   214 -KVGQVIIAGGEDEVAEFLWTHLEHAQFVEVPFLLVIGILLLYIGLSSWIISWVENWNMMDGFYF 277

  Fly   193 CFITLTTIGFGDMVALQRDNALNRKPEYVMFA---LIFILFGLAIVAASLNLL------VLRFVT 248
            ..:::.||||||:|           |...:||   |..||.||.:....::::      .|.|..
 Worm   278 VMMSVLTIGFGDLV-----------PRNEIFAVPILFIILAGLVLTTTCIDVVGAYYIDRLHFFG 331

  Fly   249 MNTED----------ERRDEAQAMQAL----QVAVKLEGDVITSNGSILSGYEGH 289
            ...:|          :||.||...:|:    :....|....:|:...:...|:.|
 Worm   332 RRLDDDPLSWLKEVQQRRIEAMKKEAMRKLFETVTALHHIRLTAFKQLTQNYDEH 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 22/69 (32%)
Ion_trans_2 169..247 CDD:285168 25/122 (20%)
twk-32NP_506416.2 Ion_trans_2 <125..180 CDD:285168 20/54 (37%)
Ion_trans_2 251..325 CDD:285168 19/84 (23%)
FN3 392..485 CDD:238020
FN3 491..580 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.