DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and twk-12

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_505731.3 Gene:twk-12 / 192074 WormBaseID:WBGene00006667 Length:684 Species:Caenorhabditis elegans


Alignment Length:319 Identity:75/319 - (23%)
Similarity:140/319 - (43%) Gaps:70/319 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVMETVVLKSE 70
            :|:....:....|...||.:|...|.:.:.:|.....:..:::.|:  :::...::.:..||:::
 Worm    16 LRSYYKFLLLIAYTAFGAWLFRTYELQADIKRRSVFGNTTNLVRRQ--LAERWIEMHKDAVLRND 78

  Fly    71 S----HKAGQ----------------------QWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLF 109
            |    .:|.:                      .|.:|||.:||..:.||||||:.|..|..|::.
 Worm    79 SALRFRRAAEAVEWLLDELNLSDHIRDLSEETPWTWTGAMFYAGQLYTTIGYGYPTTKTDEGRIC 143

  Fly   110 TMCYAIVGIPLGLVMFQSIGERVN-RLSSYVIKAVRSSL------------------------RC 149
            |:.||:.|||..|:..:|||:.:: ::..|..|..||.:                        |.
 Worm   144 TIFYALFGIPCFLMYLKSIGKTLSKKMKKYYKKLRRSRVGRILLPTRVTAMKDGFEDPEAAEERK 208

  Fly   150 KRTVASEVDLICVVTTLSSLTIAGGAAAFSKFEG-WSYFDSVYYCFITLTTIGFGDMVALQRDNA 213
            |:.....:.:|.::     :.|...|:.|..:|. |.:..:||:..::::|:|.|||        
 Worm   209 KKPFPIPIAIIMLI-----IWICFSASMFCIWEDTWVFSSAVYFFIVSISTVGLGDM-------- 260

  Fly   214 LNRKPEYVMFALIFILFGLAIVAASLNLLVLRFVTMNTE--DERRDEAQAMQALQVAVK 270
            |.|.|:.::|..:.||.|||:::....|:..|......:  ||...:.|.| |.||..|
 Worm   261 LFRTPDMMVFNFLLILVGLALLSMCFELITDRVAKWKQKRFDEHIKKVQKM-AFQVFEK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 25/54 (46%)
Ion_trans_2 169..247 CDD:285168 23/78 (29%)
twk-12NP_505731.3 Ion_trans_2 92..167 CDD:285168 25/74 (34%)
Ion_trans_2 226..>272 CDD:285168 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.