DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and shw-3

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001355445.1 Gene:shw-3 / 191761 WormBaseID:WBGene00004793 Length:500 Species:Caenorhabditis elegans


Alignment Length:188 Identity:42/188 - (22%)
Similarity:66/188 - (35%) Gaps:57/188 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDM----IIRKYNISQED-------------- 58
            ||.|.|:.:      |.|.|     .:.|..|.|..    |:|.:.::..:              
 Worm   293 IVATLTFYI------DLLSS-----MFGATADLEFFSIIRIMRLFKLTHHNSGLKILMHTFRASA 346

  Fly    59 --------FKVMETVVLKS--------ESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGK 107
                    |.|:..||..|        ||::..|........::|...:||||||..||.|..|:
 Worm   347 KELMLLVFFLVLGVVVFASLVYYAERVESNEDNQFVSIPIGLWWAIVTMTTIGYGDITPHTYLGR 411

  Fly   108 LFTMCYAIVGI-----PLGLVMFQSIGERVNRLSSYVIKAVRSSLRCKRTVASEVDLI 160
            |.....|:.|:     |:.:::       .|....|.....||.:..||.....:|.:
 Worm   412 LIGSICALAGVLTIALPVPVIV-------SNFAMFYSHTQARSKMPKKRRGVLSMDQV 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 15/58 (26%)
Ion_trans_2 165..243 CDD:462301
shw-3NP_001355445.1 BTB_POZ 25..136 CDD:453885
Ion_trans 248..444 CDD:459842 37/168 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.