DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and twk-45

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001122742.2 Gene:twk-45 / 190614 WormBaseID:WBGene00006695 Length:508 Species:Caenorhabditis elegans


Alignment Length:289 Identity:79/289 - (27%)
Similarity:126/289 - (43%) Gaps:76/289 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDA----------EDMIIRKYNISQ- 56
            |..:|.|:||.....|:.:|..:|..|||   .|..|.||:.          |.|.|.|..::. 
 Worm    81 KFGIRHITLISILAAYICLGGFLFQKLES---PREIEELQETLKSMNEIIKNETMDIIKITLTTN 142

  Fly    57 -ED--------FKVMETVVLKSES-------HKA-----GQQWKFTGAFYYATTVLTTIGYGHST 100
             ||        .:....::|::|.       ||:     ...|.|:.|.:|:.|:.:|||||..|
 Worm   143 GEDRNQKLGDLLRAYHRILLETEGKFHGSAWHKSENLDMNLMWYFSSATFYSMTLFSTIGYGTIT 207

  Fly   101 PSTVGGKLFTMCYAIVGIPLGLVMFQSIGERVNRL--SSYVI-----KAVR-SSLRCKR------ 151
            ..|..||..:|.||.:|:|:.|::...||....::  ::|:.     |::| .|:..||      
 Worm   208 CQTFWGKTVSMVYASIGLPIMLLVLGDIGVWFQKVMTNAYIFVMLKYKSLRKQSIEIKRKETLLP 272

  Fly   152 -----TVASEVDLICVVTTLSSLTIAGGAAAFSKFE----GWSYFDSVYYCFITLTTIGFGDMVA 207
                 .|.....:||.:|.|          .|...|    |.::||:.|:.||:|||||.||::.
 Worm   273 MWLAMLVVFTYIIICTLTIL----------LFDDNEGDEPGINFFDAFYFTFISLTTIGLGDVMP 327

  Fly   208 LQRDNALNRKPEYVMFALIFILFGLAIVA 236
            .        ..:|..|..:..|.|||:::
 Worm   328 Y--------NIQYSPFLPLAFLLGLALIS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 22/54 (41%)
Ion_trans_2 169..247 CDD:285168 21/72 (29%)
twk-45NP_001122742.2 Ion_trans_2 <185..241 CDD:285168 22/55 (40%)
Ion_trans_2 278..354 CDD:285168 26/89 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163741
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.