DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and twk-29

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001021467.1 Gene:twk-29 / 185828 WormBaseID:WBGene00006681 Length:476 Species:Caenorhabditis elegans


Alignment Length:265 Identity:68/265 - (25%)
Similarity:117/265 - (44%) Gaps:48/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQNVRTIS----LIVCTFTYLLVGAAVFDALESE----------TEKRRW-EALQDAEDMIIRKY 52
            :.|.|.|:    :||....|..:|..:|...|.|          .|||.. |:|.: .|..:|..
 Worm    43 QHNRRAIAVNGFIIVFLIIYTTIGGFIFLNFEFEYQQYMKQNATLEKRLCIESLLN-RDNRLRLT 106

  Fly    53 NISQEDFKVMETVVLKSESHKAGQ-QWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIV 116
            ..|.....:.|..:  :|:.|..: ||.|..|..|:..:|||:|||...|.|:.|::.|:.|...
 Worm   107 RASDVAAAIAERCL--TENVKDDRMQWSFKSAALYSLGILTTLGYGKIEPQTINGRISTVIYGFF 169

  Fly   117 GIPLGLVMFQSIGERVNRLSSYVIKAVRSSLRCKRTVASEVD------LICVVTTLSSLTIAGGA 175
            ||||.:::..:.|..:..:::    ..|..:.|:|....|.:      |..:|.....|    ||
 Worm   170 GIPLTVILLTNFGRYLEAMAT----RFRRLISCRRRREDEDENVSGSTLFFIVLVYLIL----GA 226

  Fly   176 AAFSKFEG-WSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPE---YVMFALIFILFGLAIVA 236
            .......| :.:|:.:||.||.||.|.:||::           |:   ::..::.::..||||..
 Worm   227 TMIPLMSGQFDFFNGIYYAFICLTAIEYGDII-----------PQNNWFLPISVFYMCTGLAIST 280

  Fly   237 ASLNL 241
            .:|::
 Worm   281 IALDI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 21/54 (39%)
Ion_trans_2 169..247 CDD:285168 20/77 (26%)
twk-29NP_001021467.1 Ion_trans_2 127..186 CDD:285168 21/58 (36%)
Ion_trans_2 216..292 CDD:285168 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.