DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kvs-1

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001360715.1 Gene:kvs-1 / 183753 WormBaseID:WBGene00002242 Length:499 Species:Caenorhabditis elegans


Alignment Length:167 Identity:38/167 - (22%)
Similarity:61/167 - (36%) Gaps:46/167 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISLIVCTFTYLLVGAAVF--DALESETEK------RRWEALQDAEDMIIRKYNISQEDFKVMETV 65
            :.:|.....||.:|.|:|  |.......|      |....|:....:.:.:|:.....|    .:
 Worm   321 VDMIAIIPFYLELGLALFGIDVASLSDIKGALLVVRVLRVLRVVRILKLGRYSSGMRTF----AL 381

  Fly    66 VLKSESHKAG------------------------QQWKFT---GAFYYATTVLTTIGYGHSTPST 103
            .|||.:.:.|                        :...||   .||::|...:||:|||...|.|
 Worm   382 TLKSSARQLGMMGMVLSTGVVFFSTLLYFVEKDEKDTPFTSIPAAFWWAIVTMTTVGYGDYVPVT 446

  Fly   104 VGGKLFTMCYAIVGI-----PLGLVM--FQSIGERVN 133
            |.|||......|.|:     |:.:::  |..:...||
 Worm   447 VPGKLIASGAIISGVLVLALPITIIVDNFMKVSGNVN 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 20/63 (32%)
Ion_trans_2 165..243 CDD:462301
kvs-1NP_001360715.1 BTB_POZ_Kv 73..163 CDD:349626
Ion_trans 279..475 CDD:459842 35/157 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.