DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and twk-39

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001076639.1 Gene:twk-39 / 182864 WormBaseID:WBGene00006690 Length:676 Species:Caenorhabditis elegans


Alignment Length:81 Identity:21/81 - (25%)
Similarity:25/81 - (30%) Gaps:37/81 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 CLLD-NGGVTNGTLKLSFPVTGSTTPEATIQQFQTALQLASSNSNSKSQITESIGCSYAQCQSRL 142
            |:|. ||.|||.||:                      |.|||.             :......|.
 Worm   109 CILSANGCVTNVTLR----------------------QPASSG-------------AIVTLHGRY 138

  Fly   143 DILCLFSHSSTVPPLP 158
            :||.|.. |...||.|
 Worm   139 EILSLLG-SILPPPAP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 13/53 (25%)
Ion_trans_2 165..243 CDD:462301
twk-39NP_001076639.1 Ion_trans_2 <121..177 CDD:462301 14/69 (20%)
Ion_trans_2 498..580 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.