DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and twk-18

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001379714.1 Gene:twk-18 / 181139 WormBaseID:WBGene00006672 Length:461 Species:Caenorhabditis elegans


Alignment Length:335 Identity:81/335 - (24%)
Similarity:136/335 - (40%) Gaps:77/335 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISLIVCTF--------------TYLLVGAAVFDALESETEKRRWEALQDAEDMIIRK--YNISQE 57
            :|.|:.||              .|.|:||.:|..:|.|.|:......|...|.:||:  |.|:|.
 Worm     8 VSTILTTFQKTFKGLLPLIILVAYTLLGAWIFWMIEGENEREMLIEQQKERDELIRRTVYKINQL 72

  Fly    58 DFKVMETVVLKSESHKAGQQ---------------------WKFTGAFYYATTVLTTIGYGHSTP 101
            ..|....::...|.:....:                     |.|.|:.:|..||.||||||:..|
 Worm    73 QIKRQRRLMTAEEEYNRTAKVLTTFQETLGIVPADMDKDIHWTFLGSIFYCMTVYTTIGYGNIVP 137

  Fly   102 STVGGKLFTMCYAIVGIPLGLVMFQSIG----ERVNRLSSYVIKAVR-SSLRCKRTVASEVDLIC 161
            .|..|:..|:.||.:||||.::....:|    :....|..:.:|:.| .|......::...|.|.
 Worm   138 GTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKGCKMLWRFFLKSTRVVSKDLSNKISEAADNIE 202

  Fly   162 VVTT---------------LSSLTIAG-----------GAAAFSKFEGWSYFDSVYYCFITLTTI 200
            ..||               |.|..|:|           .|..|:..|.|.:..|:|:..|:.|||
 Worm   203 EGTTAITPSAEKTENNDDDLLSFPISGLLLITVIWVIFCAVLFTFLEEWDFGTSLYFTLISFTTI 267

  Fly   201 GFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASLNLLVLRFVTMNTEDERRDEAQAMQAL 265
            ||||::....|        ::....:.:|.||::|:..:.|:..:...:.:..:...:.:..:||
 Worm   268 GFGDILPSDYD--------FMPIVGVLLLIGLSLVSTVMTLIQQQIEALASGMKDNIDQEYARAL 324

  Fly   266 QVAVKLEGDV 275
            ..| :.:|:|
 Worm   325 NEA-REDGEV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 23/79 (29%)
Ion_trans_2 169..247 CDD:285168 22/88 (25%)
twk-18NP_001379714.1 Ion_trans_2 <114..170 CDD:400301 23/55 (42%)
Ion_trans_2 232..306 CDD:400301 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.