DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and twk-16

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_508526.2 Gene:twk-16 / 180594 WormBaseID:WBGene00006670 Length:555 Species:Caenorhabditis elegans


Alignment Length:268 Identity:64/268 - (23%)
Similarity:117/268 - (43%) Gaps:59/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLIVCTFTYLLVGAAVFDALE--SETEKRRWEALQDAEDMIIRKYNISQEDFKVMETVVLKS--E 70
            ||::....|..:|..:||.:|  :..|.:|       .:.|.|...:||    ::.::...|  :
 Worm    28 SLLMLVLLYSFLGGFIFDRIETNAHAEMKR-------NERINRTACVSQ----ILHSIHRWSHNQ 81

  Fly    71 SHKA----------------GQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIP 119
            :||.                ..:|.|..|..|...::||:||....|.|..|::|.:.|.|.|||
 Worm    82 THKVQYAEDIADCFEPEKDERSEWNFVTATLYGFGIVTTLGYNRIAPITYTGRMFCIVYGICGIP 146

  Fly   120 LGLVMFQSIGERVNRL---SSYVIKAVRSSLR-CKRTVASEV-----------DLICVVTTLSSL 169
            :.:::..::|:.:|..   |...|:|.|...| .|.::|.::           .|:||..    :
 Worm   147 VTMIIIANVGQYLNNFAGDSRRKIEAYRQQRRMSKASLAGKIYKESSIQVTSLALLCVFL----I 207

  Fly   170 TIAGGAAAFSKFEG-WSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLA 233
            .:|.||.......| ..:|:.:|:.|:.||.|.||.:|.:        :.|.:....:::..|||
 Worm   208 YVAVGALLLPLLNGELDFFNGLYFNFLCLTAIDFGQLVPI--------RVELLPITFLYVCIGLA 264

  Fly   234 IVAASLNL 241
            |...::|:
 Worm   265 ITTIAINI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 18/54 (33%)
Ion_trans_2 169..247 CDD:285168 19/74 (26%)
twk-16NP_508526.2 Ion_trans_2 <102..159 CDD:285168 18/56 (32%)
Ion_trans_2 204..279 CDD:285168 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.