DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and twk-46

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_741678.1 Gene:twk-46 / 180252 WormBaseID:WBGene00006696 Length:319 Species:Caenorhabditis elegans


Alignment Length:280 Identity:83/280 - (29%)
Similarity:134/280 - (47%) Gaps:24/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAE----DMIIR----KYNISQE 57
            |::.|:|.:..:.....||.|||.||..:|...||...||..|.:    |.:|:    :..|.:.
 Worm    20 MRESNMRILVGLGVAVVYLFVGAIVFVRIEYPLEKIEREAYLDYQNQWRDRLIQLDIDESEIDKL 84

  Fly    58 DFKVMETV---VLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIP 119
            ...:.|..   :....:..:...|.|..||::|.|:::|:|||..:|.|..|||||:.|.::|||
 Worm    85 FLNIREAALNGIWMDRNLTSDPNWTFGQAFFFAGTLISTVGYGRVSPRTEYGKLFTILYCVIGIP 149

  Fly   120 LGLVMFQSIGERVNRLSSYVIKAVRSSLRCKRTVASEVDLICVVTTLSSLTI---AGGAAAFSKF 181
            |.|.:..:|..|: |..|:.::.:.:.........:.:.||.|....:||.:   |..|..||..
 Worm   150 LTLALLSAIVARM-REPSHKLRGLLNQRLGHLFTVNHIQLIHVGVVFASLLLFVFAIPAWVFSSI 213

  Fly   182 E-GWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASLNLL--- 242
            | .|||.|:.||||::|||||.||.......|. :.:..|.:.|.::::.||..:...|..|   
 Worm   214 ETDWSYLDAFYYCFVSLTTIGLGDFEPGDDPNQ-SFRGLYKIGATVYLMGGLCCMMLFLATLYDI 277

  Fly   243 ----VLRFVTMNTEDERRDE 258
                :..|...:.|:.|..|
 Worm   278 PQFNLTSFFVKSDEEMRFSE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 24/54 (44%)
Ion_trans_2 169..247 CDD:285168 28/88 (32%)
twk-46NP_741678.1 Ion_trans_2 <107..164 CDD:285168 25/57 (44%)
Ion_trans_2 198..274 CDD:285168 27/76 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163778
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.