DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and twk-14

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001367281.1 Gene:twk-14 / 179699 WormBaseID:WBGene00006669 Length:463 Species:Caenorhabditis elegans


Alignment Length:303 Identity:77/303 - (25%)
Similarity:139/303 - (45%) Gaps:56/303 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQ----DAEDMIIRKYNISQEDFKVME 63
            ::|.|.:.:.:....||..||.:|..||.|.|.....|:.    |.:.:..:...:::.||:  |
 Worm    71 EENARFVLICIILIVYLAFGAILFHWLEWENEVDERIAIDNRMADYQKVYCKHKPLNECDFE--E 133

  Fly    64 TVVLKSESHKAG-----QQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLV 123
            .|...|:...:|     .::...|:.:::.||::|||:|.|||.|..|:..|:.|.:||....::
 Worm   134 MVRFISDGATSGLLNSRSRFDHLGSLFFSATVISTIGFGTSTPRTHLGRFITIVYGVVGCTCCVL 198

  Fly   124 MFQSIGERVNRLSSYVIKAVRS---SLRCKRTVASEVDLI------------C------------ 161
            .|....||:....||:::::|.   ..|.|.:....|.|:            |            
 Worm   199 FFNLFLERLVTGMSYILRSLRERKIRYRLKESGNKPVTLLLNNEDFNESSSSCGGHMDNWRPSVY 263

  Fly   162 ----VVTTLSSLTIAGGAAAFSKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPE--- 219
                ::.::..:.|...|..:|..|.|:|.||:|:|||:..||||||.|:.|:| .....|:   
 Worm   264 KVFFILFSMCLVLITASAGIYSVVENWNYIDSLYFCFISFATIGFGDYVSNQQD-VTRMSPDLYR 327

  Fly   220 YVMFALI-------FILFGLA--IVAASLNLLVLRFVTMNTED 253
            :|.|.|:       :.|..::  :|...||.::.: :.:..||
 Worm   328 FVNFCLLTLGACFFYCLSNVSSIVVRQLLNWMIKK-MDVKVED 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 18/54 (33%)
Ion_trans_2 169..247 CDD:285168 29/89 (33%)
twk-14NP_001367281.1 Ion_trans_2 149..208 CDD:400301 19/58 (33%)
Ion_trans_2 272..353 CDD:400301 26/81 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.