DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and exp-2

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001367760.1 Gene:exp-2 / 179003 WormBaseID:WBGene00001374 Length:510 Species:Caenorhabditis elegans


Alignment Length:121 Identity:30/121 - (24%)
Similarity:59/121 - (48%) Gaps:28/121 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 LSSLTIAGGAAAFS-------KFEGWSYFDSV----YYCFITLTTIGFGDMVALQRDNALNRKPE 219
            :.::.:..|...||       |.|..:.|.|:    ::|.:|:||:|:||.|           |.
 Worm   395 MMTIVLLTGVVFFSTMIYFLEKDEEGTPFTSIPAAYWWCIVTMTTVGYGDAV-----------PA 448

  Fly   220 YVMFALI---FILFGLAIVAASLNLLVLRFVTMNTEDERRDEAQA--MQALQVAVK 270
            ..|..:|   .|:.|:.::|..:.::|..|:.: .:||::.|.|.  .|:.|:|::
 Worm   449 TTMGKIIASAAIMCGVLVLALPITIIVDNFIKV-AQDEQQAEQQKNDQQSEQLALE 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301
Ion_trans_2 165..243 CDD:462301 21/90 (23%)
exp-2NP_001367760.1 BTB_2 79..178 CDD:426665
Ion_trans 292..478 CDD:459842 22/93 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.