DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and egl-23

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001255775.1 Gene:egl-23 / 178358 WormBaseID:WBGene00001190 Length:726 Species:Caenorhabditis elegans


Alignment Length:294 Identity:68/294 - (23%)
Similarity:120/294 - (40%) Gaps:94/294 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVMETVVL--- 67
            ::.:|.:.|:          ||.|:.:..|    ||.:.       |:::.|....:..|:.   
 Worm   159 IKKMSSMECS----------FDTLDEKLVK----ALDEC-------YHVAVEHNTHVNHVLFTNS 202

  Fly    68 KSESHKAGQ-------QWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMF 125
            |.|....|:       :|.|..:..:|.||:||||||:..|.|.||:||.:.|.::|||..|:..
 Worm   203 KEEVESVGEEAEEDVSEWSFMDSLLFAFTVITTIGYGNVAPRTFGGRLFVIGYGLIGIPFTLLAI 267

  Fly   126 QSIGERVNRLSSYVIKAVRSSLRCKRT-------------------------------------- 152
            ..:|:.::.:      .|.:...|::|                                      
 Worm   268 ADLGKFISEM------MVEAKSFCRKTWKKLKKAWNPNFIRAKDLSNTDIEEKILDNEKIENEPE 326

  Fly   153 ---VASEVDLICVVTTLSSL------TIAGGAAAFSKFE-GWSYFDSVYYCFITLTTIGFGDMVA 207
               |:.|.|.: ..|..:||      .||.|....:.:| ...:|.:||:.|:|||:||.||:|.
 Worm   327 TSEVSEEEDDL-TETEATSLFILFLVYIAFGGFMLAAYEPDMDFFKAVYFNFVTLTSIGLGDIVP 390

  Fly   208 LQRDNALNRKPEYVMFALIFILFGLAIVAASLNL 241
                    |...|::..:::|..|||:...::.:
 Worm   391 --------RSETYMLITIVYIAIGLALTTIAIEI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 23/54 (43%)
Ion_trans_2 169..247 CDD:285168 23/80 (29%)
egl-23NP_001255775.1 Ion_trans_2 216..276 CDD:285168 23/59 (39%)
Ion_trans_2 347..423 CDD:285168 22/78 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163780
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.