DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and twk-5

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001021896.1 Gene:twk-5 / 174756 WormBaseID:WBGene00006660 Length:281 Species:Caenorhabditis elegans


Alignment Length:283 Identity:65/283 - (22%)
Similarity:118/283 - (41%) Gaps:80/283 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVMETVVLKSES 71
            :.|.:::.| |.:|||||:|.:::.                                  ||..:|
 Worm    17 QAIIVLILT-TLMLVGAAIFQSIDP----------------------------------VLGEQS 46

  Fly    72 HKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGERVNRL- 135
                    |....::....::|||||:..|.|...::|::.::|:||||.:|...:.|:.:.:. 
 Worm    47 --------FYEVVFFEFITISTIGYGNQYPQTHASRVFSIFFSILGIPLLVVTLGNFGKYLTKFY 103

  Fly   136 ---SSYVIKAVRSSLRCKRTVASEVDLI-CVVTTLSSLTIAGGAAAFSKFEGWSY-FDSVYYCFI 195
               ..::.     |.|.:..:.::.|:. .|:..|..||.|.| ..|....|.:| .|..|:.||
 Worm   104 WKTHGWIF-----SERTESELVNDKDMPGIVIACLYLLTFAIG-FFFIPHSGAAYSIDDCYFSFI 162

  Fly   196 TLTTIGFGDMVALQRDNALNRKPEYVMF-----ALIFILFGLAIVAASLNLLVLRFVT-MNTEDE 254
            :..|:||||.|           |:...|     .:.::::|     ..||::::.:|| ..|:..
 Worm   163 SFATVGFGDKV-----------PQIDTFEKFCKVITYLVWG-----TILNIMLISYVTNWFTQLF 211

  Fly   255 RRDEAQAMQALQVAVKLEGDVIT 277
            .|   |..:...|.|.:.|..||
 Worm   212 AR---QPFRGTDVEVMIGGQCIT 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 16/54 (30%)
Ion_trans_2 169..247 CDD:285168 22/83 (27%)
twk-5NP_001021896.1 Ion_trans_2 22..101 CDD:285168 27/121 (22%)
Ion_trans_2 135..209 CDD:285168 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.