DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and twk-3

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_495727.1 Gene:twk-3 / 174321 WormBaseID:WBGene00006658 Length:383 Species:Caenorhabditis elegans


Alignment Length:265 Identity:60/265 - (22%)
Similarity:120/265 - (45%) Gaps:54/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIVCTFTYLLVGAAVFDALESETE-KRRWEALQDAEDM-------IIRKYNISQEDFKV--METV 65
            |::...||.|.||.:|.::|...| |||.:|:::.:|:       |......|::..::  .:.:
 Worm    44 LVLSCVTYALGGAYLFLSIEHPEELKRREKAIREFQDLKQQFMGNITSGIENSEQSIEIYTKKLI 108

  Fly    66 VLKSESHKA-------------GQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVG 117
            ::..::|.|             ...|.|:.|..:.||.:..:|||:..|.:..|::..:.||::|
 Worm   109 LMLEDAHNAHAFEYFFLNHEIPKDMWTFSSALVFTTTTVIPVGYGYIFPVSAYGRMCLIAYALLG 173

  Fly   118 IPLGLVMFQSIG----ERVNRLSSYVIKAVRSSLRCKRTVASEVDLICVVTTLSSLTIAGGAAAF 178
            |||.||.....|    :.|.|.......|:.:::......|..:.:..::.:.|::|        
 Worm   174 IPLTLVTMADTGKFAAQLVTRWFGDNNMAIPAAIFVCLLFAYPLVVGFILCSTSNIT-------- 230

  Fly   179 SKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEY-VMFALIFILFGLAIVAASLNLL 242
                   |.||||:...::.||||||:.           |:. |:..::|:..|:.:|..:|:::
 Worm   231 -------YLDSVYFSLTSIFTIGFGDLT-----------PDMNVIHMVLFLAVGVILVTITLDIV 277

  Fly   243 VLRFV 247
            ....:
 Worm   278 AAEMI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 19/58 (33%)
Ion_trans_2 169..247 CDD:285168 18/78 (23%)
twk-3NP_495727.1 Ion_trans_2 <134..190 CDD:285168 19/55 (35%)
Ion_trans_2 211..283 CDD:285168 20/98 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.