DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcnk2

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_742039.1 Gene:Kcnk2 / 170899 RGDID:621448 Length:426 Species:Rattus norvegicus


Alignment Length:286 Identity:93/286 - (32%)
Similarity:143/286 - (50%) Gaps:53/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNI--------SQE 57
            ||.:.|.||.|:|  ..||::||.||.|||...|      :.....::|:|.|.        |.|
  Rat    57 MKWKTVSTIFLVV--VLYLIIGATVFKALEQPQE------ISQRTTIVIQKQNFIAQHACVNSTE 113

  Fly    58 DFKVMETVV---------LKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCY 113
            ..::::.:|         |.:.|::. ..|....:|::|.||:||||:|:.:|.|.|||:|.:.|
  Rat   114 LDELIQQIVTAINAGIIPLGNNSNQV-SHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIY 177

  Fly   114 AIVGIPLGLVMFQSIGERVNRLSSYVIKAVRSSL------RCKRTVASEVDLI---CVVTTLSSL 169
            |::||||...:...:|:::..:....|..|..:.      :.|..:.|.:..|   ||      |
  Rat   178 ALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCV------L 236

  Fly   170 TIAGGAAAFSKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMF----ALIFILF 230
            .:|..|..|...||||..|::|:..||||||||||.||...|      .||:.|    ...:||.
  Rat   237 FVALPAVIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSD------IEYLDFYKPVVWFWILV 295

  Fly   231 GLAIVAASLNLL--VLRFVTMNTEDE 254
            |||..||.|:::  .||.::..|::|
  Rat   296 GLAYFAAVLSMIGDWLRVISKKTKEE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 23/54 (43%)
Ion_trans_2 169..247 CDD:285168 36/83 (43%)
Kcnk2NP_742039.1 Ion_trans_2 <139..196 CDD:285168 23/57 (40%)
Ion_trans_2 234..312 CDD:285168 36/89 (40%)
Required for basal channel activity. /evidence=ECO:0000250|UniProtKB:P97438 354..426
Essential for chloroform and halothane sensitivity. /evidence=ECO:0000250|UniProtKB:P97438 378..426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349009
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.