DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcnk7

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_034739.2 Gene:Kcnk7 / 16530 MGIID:1341841 Length:343 Species:Mus musculus


Alignment Length:248 Identity:64/248 - (25%)
Similarity:111/248 - (44%) Gaps:32/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYN---ISQEDFKVMETVVLK 68
            |.:.|::.....:.:||.|..|||. ...|..:|...||....:..:   :..|..:.:...||:
Mouse     9 RYLLLLMAHLLAMGLGAVVLQALEG-PPARHLQAQVQAELASFQAEHRACLPPEALEELLGAVLR 72

  Fly    69 SESHKAG--------QQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMF 125
            :::|...        ..|....|..:..::|||.||||..|.:.|||.|.:.||.:|:|..|.:.
Mouse    73 AQAHGVSSLGNSSETSNWDLPSALLFTASILTTTGYGHMAPLSSGGKAFCVVYAALGLPASLALV 137

  Fly   126 QSIGERV----NRLSSYVIKAVRSSLRCKRTV---ASEVDLI--CVVTTLSSLTIAGGAAAFSKF 181
            .::...:    :|...:|  |:|..|...:..   |:.:.|:  ||...|.:|.:.|       .
Mouse   138 AALRHCLLPVFSRPGDWV--AIRWQLAPAQAALLQAAGLGLLVACVFMLLPALVLWG-------V 193

  Fly   182 EG-WSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALI-FILFGL 232
            :| .|..:::|:||.:|:|||.||::................|||: ::|.||
Mouse   194 QGDCSLLEAIYFCFGSLSTIGLGDLLPAHGRGLHPAIYHLGQFALLGYLLLGL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 19/54 (35%)
Ion_trans_2 169..247 CDD:285168 19/66 (29%)
Kcnk7NP_034739.2 Ion_trans_2 <89..140 CDD:285168 19/50 (38%)
Ion_trans_2 178..>225 CDD:285168 16/53 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.