DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcnk5

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_067517.1 Gene:Kcnk5 / 16529 MGIID:1336175 Length:502 Species:Mus musculus


Alignment Length:288 Identity:88/288 - (30%)
Similarity:142/288 - (49%) Gaps:31/288 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYN-ISQEDF-KVMETVVLKSESHKA--GQQ- 77
            ||.:|||:|:.||....|...:.....:..:::::. :|||.. |:::.|...::...|  |.| 
Mouse    15 YLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLSQEGLDKILQVVSDAADQGVAITGNQT 79

  Fly    78 ---WKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGE----RVNRL 135
               |.:..|..:|.||:||||||:..|.|..|:||.:.|.:.|:||.|....::|:    |..||
Mouse    80 FNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGLFGVPLCLTWISALGKFFGGRAKRL 144

  Fly   136 SSYVIKAVRSSLRCKRTVASEVDLICVVTTLSSLTIAGGAAAFSKFEGWSYFDSVYYCFITLTTI 200
            ..::.:. ..|||..:...:.:.::..|  |..|.|.  ...|...|.|:|.:.:||.|||::||
Mouse   145 GQFLTRR-GVSLRKAQITCTAIFIVWGV--LVHLVIP--PFVFMVTEEWNYIEGLYYSFITISTI 204

  Fly   201 GFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASLNLLVLRFV----TMNTEDERRDEA-- 259
            ||||.||....:| |....|..|..::|..|||.::..:|..|..||    .:.....||.|:  
Mouse   205 GFGDFVAGVNPSA-NYHALYRYFVELWIYLGLAWLSLFVNWKVSMFVEVHKAIKKRRRRRKESFE 268

  Fly   260 ---QAMQALQVAVKLEGDVITSNGSILS 284
               .:.:|||:|    |...:.:.:|.|
Mouse   269 SSPHSRKALQMA----GSTASKDVNIFS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 23/62 (37%)
Ion_trans_2 169..247 CDD:285168 29/77 (38%)
Kcnk5NP_067517.1 Ion_trans_2 <81..137 CDD:285168 22/55 (40%)
Ion_trans_2 171..243 CDD:285168 29/76 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845597
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.