DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcnc1

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_006540709.1 Gene:Kcnc1 / 16502 MGIID:96667 Length:594 Species:Mus musculus


Alignment Length:125 Identity:31/125 - (24%)
Similarity:50/125 - (40%) Gaps:26/125 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 FYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI-----PLGLV-----MFQSIGERVNRLSSY 138
            |::|...:||:|||...|.|..|.|.....|:.|:     |:.::     |:.|:.....:|...
Mouse   391 FWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKK 455

  Fly   139 VIKAV------RSSLRCKRTV-----ASEVDLICVVTTLSSLTIAGGAAAF----SKFEG 183
            ..|.:      .|...||..|     :::.| .|.:.....|.|...|:|:    ||..|
Mouse   456 KKKHIPRPPQLGSPNYCKSVVNSPHHSTQSD-TCPLAQEEILEINRAASAYMFEDSKLNG 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 16/57 (28%)
Ion_trans_2 165..243 CDD:462301 7/23 (30%)
Kcnc1XP_006540709.1 BTB_KCNC1_3 6..122 CDD:349721
Ion_trans 189..447 CDD:459842 16/55 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.