DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcna5

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_666095.1 Gene:Kcna5 / 16493 MGIID:96662 Length:602 Species:Mus musculus


Alignment Length:59 Identity:20/59 - (33%)
Similarity:31/59 - (52%) Gaps:1/59 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VMETVVLKSESHKAGQQW-KFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI 118
            :..:.|..:|:...|..: ....||::|...:||:|||...|.|||||:.....||.|:
Mouse   436 LFSSAVYFAEADNQGSHFSSIPDAFWWAVVTMTTVGYGDMRPITVGGKIVGSLCAIAGV 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 17/42 (40%)
Ion_trans_2 165..243 CDD:462301
Kcna5NP_666095.1 Tetramerization domain. /evidence=ECO:0000250|UniProtKB:P22460 1..202
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..107
BTB_POZ 111..237 CDD:453885
Ion_trans 240..515 CDD:459842 20/59 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 274..297
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 407..420
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 469..474 3/4 (75%)
PDZ-binding 600..602
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.