DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcna4

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_067250.2 Gene:Kcna4 / 16492 MGIID:96661 Length:654 Species:Mus musculus


Alignment Length:120 Identity:24/120 - (20%)
Similarity:46/120 - (38%) Gaps:46/120 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQNVRTISLIVCTFTYLLVGAAVFDA----LESETEKRRWEALQDAEDMIIRKYNISQEDFKVME 63
            :.::|.:.|::   .:|.:|..:|.:    .|::.....::::.|                    
Mouse   473 RASMRELGLLI---FFLFIGVILFSSAVYFAEADEPTTHFQSIPD-------------------- 514

  Fly    64 TVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI 118
                               ||::|...:||:|||...|.|||||:.....||.|:
Mouse   515 -------------------AFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGV 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 17/41 (41%)
Ion_trans_2 165..243 CDD:462301
Kcna4NP_067250.2 K_channel_TID 1..>37 CDD:429748
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..145
BTB_POZ 177..304 CDD:453885
Ion_trans 307..571 CDD:459842 24/120 (20%)
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 463..476 0/2 (0%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 525..530 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 630..654
PDZ-binding. /evidence=ECO:0000250|UniProtKB:P15385 652..654
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.